Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96FA3
Gene Names PELI1
Alternative Names Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)
Expression Region Full Length(1-418aa )
Molecular Weight 48.8 kDa
Protein Sequence MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation.
Involvement in Disease
Subcellular Location
Protein Families Pellino family
Tissue Specificity PELI1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PBUb08569445

Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human E3 ubiquitin-protein ligase pellino homolog 1(PELI1)
Copyright © 2021-present Echo Biosystems. All rights reserved.