Specification
| Organism | Homo sapiens (Human) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9P0N8 |
| Gene Names | MARCH2 |
| Alternative Names | Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II |
| Expression Region | Full Length(1-246aa ) |
| Molecular Weight | 43 kDa |
| Protein Sequence | MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6. |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein |
| Protein Families | |
| Tissue Specificity | MARCH2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |