Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q7Z6Z7 |
| Gene Names | HUWE1 |
| Alternative Names | (ARF-binding protein 1)(ARF-BP1)(HECT, UBA and WWE domain-containing protein 1)(HECT-type E3 ubiquitin transferase HUWE1)(Homologous to E6AP carboxyl terminus homologous protein 9)(HectH9)(Large structure of UREB1)(LASU1)(Mcl-1 ubiquitin ligase E3)(Mule)(Upstream regulatory element-binding protein 1)(URE-B1)(URE-binding protein 1) |
| Expression Region | 4005-4374aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.454 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-568℃. |
| Protein Length | Partial |
| Molecular Weight | 50.7 kDa |
| Protein Sequence | LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA |
Background
| Research Areas | Cell Biology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |