Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-B2M-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P49792
Gene Names RANBP2
Alternative Names 358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2
Expression Region Partial(2601-2802aa )
Molecular Weight 36.8 kDa
Protein Sequence PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle
Involvement in Disease Encephalopathy, acute, infection-induced, 3 (IIAE3)
Subcellular Location Nucleus, Nucleus membrane, Nucleus, nuclear pore complex, Nucleus envelope
Protein Families RanBP2 E3 ligase family
Tissue Specificity RANBP2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$230.00
In stock
SKU
EB-PE1HU19436

Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human E3 SUMO-protein ligase RanBP2(RANBP2),partial
Copyright © 2026-present Echo Bio. All rights reserved.