Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens dynein light chain roadblock-type 1 (DYNLRB1), transcript variant 1 (NM_014183). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NP97 |
| Entry Name | DLRB1_HUMAN |
| Gene Names | DYNLRB1 BITH DNCL2A DNLC2A ROBLD1 HSPC162 |
| Alternative Gene Names | BITH DNCL2A DNLC2A ROBLD1 |
| Alternative Protein Names | Dynein light chain roadblock-type 1 (Bithoraxoid-like protein) (BLP) (Dynein light chain 2A, cytoplasmic) (Dynein-associated protein Km23) (Roadblock domain-containing protein 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 96 |
| Molecular Weight(Da) | 10922 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE |
Background
| Function | FUNCTION: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
| Pathway | |
| Protein Families | GAMAD family |
| Tissue Specificity | High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients. {ECO:0000269|PubMed:11750132}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
