Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens dynein light chain LC8-type 1 (DYNLL1), transcript variant 2 (NM_001037495). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P63167 |
| Entry Name | DYL1_HUMAN |
| Gene Names | DYNLL1 DLC1 DNCL1 DNCLC1 HDLC1 |
| Alternative Gene Names | DLC1 DNCL1 DNCLC1 HDLC1 |
| Alternative Protein Names | Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 89 |
| Molecular Weight(Da) | 10366 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Background
| Function | FUNCTION: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; FUNCTION: Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.; FUNCTION: Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1. {ECO:0000269|PubMed:15891768, ECO:0000269|PubMed:16684779}.; FUNCTION: Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity. {ECO:0000269|PubMed:10198631, ECO:0000269|PubMed:15193260}. |
| Pathway | |
| Protein Families | Dynein light chain family |
| Tissue Specificity | Ubiquitous (PubMed:8628263). Expressed in testis (PubMed:22965910). {ECO:0000269|PubMed:22965910, ECO:0000269|PubMed:8628263}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |