Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9NP97 |
| Gene Names | DYNLRB1 |
| Alternative Names | Bithoraxoid-like protein ;BLPDynein light chain 2A, Cytoplasmic domainDynein-associated protein Km23Roadblock domain-containing protein 1 |
| Expression Region | Partial(3-96aa ) |
| Molecular Weight | 26.7 kDa |
| Protein Sequence | EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytoskeleton |
| Protein Families | GAMAD family |
| Tissue Specificity | DYNLRB1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |