Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9BV47
Gene Names DUSP26
Alternative Names Dual specificity phosphatase SKRP3Low-molecular-mass dual-specificity phosphatase 4 ;DSP-4 ;LDP-4Mitogen-activated protein kinase phosphatase 8 ;MAP kinase phosphatase 8 ;MKP-8Novel amplified gene in thyroid anaplastic cancer
Expression Region Full Length(1-211aa )
Molecular Weight 39.9 kDa
Protein Sequence MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Involvement in Disease
Subcellular Location Cytoplasm, Nucleus, Golgi apparatus
Protein Families Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Tissue Specificity DUSP26
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE8HU863253

Recombinant Human Dual specificity protein phosphatase 26(DUSP26)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Dual specificity protein phosphatase 26(DUSP26)
Copyright © 2021-present Echo Biosystems. All rights reserved.