Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q6B8I1 |
Gene Names | DUSP13 |
Alternative Names | Branching-enzyme interacting DSPMuscle-restricted DSP ;MDSP |
Expression Region | Full Length(1-198aa ) |
Molecular Weight | 36.7 kDa |
Protein Sequence | MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Probable protein tyrosine phosphatase. Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by AKT1. Shows no phosphatase activity on MAPK1/ERK2, MAPK8/JNK, MAPK14/p38 and MAP3K5/ASK1. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily |
Tissue Specificity | DUSP13 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |