Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens diphthamide biosynthesis 3 (DPH3), transcript variant 1 (NM_206831). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96FX2 |
| Entry Name | DPH3_HUMAN |
| Gene Names | DPH3 DESR1 ZCSL2 |
| Alternative Gene Names | DESR1 ZCSL2 |
| Alternative Protein Names | DPH3 homolog (CSL-type zinc finger-containing protein 2) (DelGEF-interacting protein 1) (DelGIP1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 82 |
| Molecular Weight(Da) | 9240 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC |
Background
| Function | FUNCTION: Essential for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in elongation factor 2 (EEF2) and which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta). {ECO:0000250}.; FUNCTION: Down-regulation increases extracellular release of proteoglycans, indicating a possible role in the secretion process. Stimulates binding of GNEFR to SEC5. {ECO:0000269|PubMed:14527407, ECO:0000269|PubMed:14980502}. |
| Pathway | Protein modification; peptidyl-diphthamide biosynthesis. |
| Protein Families | DPH3 family |
| Tissue Specificity | Widely expressed with highest levels in small intestine, spleen, thymus, heart, liver and lung. {ECO:0000269|PubMed:14527407, ECO:0000269|PubMed:14980502}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |