Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens DnaJ heat shock protein family (Hsp40) member C19 (DNAJC19), transcript variant 1 (NM_145261). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96DA6 |
| Entry Name | TIM14_HUMAN |
| Gene Names | DNAJC19 TIM14 TIMM14 |
| Alternative Gene Names | TIM14 TIMM14 |
| Alternative Protein Names | Mitochondrial import inner membrane translocase subunit TIM14 (DnaJ homolog subfamily C member 19) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 116 |
| Molecular Weight(Da) | 12499 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
Background
| Function | FUNCTION: Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling (By similarity). May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity). {ECO:0000250|UniProtKB:Q07914, ECO:0000250|UniProtKB:Q9CQV7}. |
| Pathway | |
| Protein Families | TIM14 family |
| Tissue Specificity | Ubiquitously expressed. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |