Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens DnaJ heat shock protein family (Hsp40) member B3 (DNAJB3) (NM_001001394). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WWF6 |
| Entry Name | DNJB3_HUMAN |
| Gene Names | DNAJB3 HCG3 |
| Alternative Gene Names | HCG3 |
| Alternative Protein Names | DnaJ homolog subfamily B member 3 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 145 |
| Molecular Weight(Da) | 16559 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ |
Background
| Function | FUNCTION: May operate as a co-chaperone of the male germ cell- and haploid stage-specific Hsp70 proteins. {ECO:0000305}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in sperm (at protein level). {ECO:0000269|PubMed:18184612}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |