Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9Y2Y1 |
| Gene Names | POLR3K |
| Alternative Names | DNA-directed RNA polymerase III subunit KRNA polymerase III 12.5KDA subunit ;RPC12.5RNA polymerase III subunit C11 ;HsC11p ;RPC11 ;hRPC11 |
| Expression Region | Full Length(1-108aa ) |
| Molecular Weight | 28.3 kDa |
| Protein Sequence | MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as tplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway . |
| Involvement in Disease | |
| Subcellular Location | Nucleus, nucleolus |
| Protein Families | Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family |
| Tissue Specificity | POLR3K |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
