Recombinant Human DNA-directed RNA polymerase I subunit RPA12(ZNRD1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9P1U0
Gene Names ZNRD1
Alternative Names Zinc ribbon domain-containing protein 1
Expression Region Full Length(1-126aa )
Molecular Weight 29.9 kDa
Protein Sequence MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Involvement in Disease
Subcellular Location Nucleus, nucleolus
Protein Families Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family
Tissue Specificity ZNRD1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1HU885916

Recombinant Human DNA-directed RNA polymerase I subunit RPA12(ZNRD1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DNA-directed RNA polymerase I subunit RPA12(ZNRD1)
Copyright © 2021-present Echo Biosystems. All rights reserved.