Recombinant Human DMAC2L protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens ATP synthase, H+ transporting, mitochondrial Fo complex subunit s (factor B) (DMAC2L), transcript variant 2 (NM_001003805).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q99766
Entry Name ATP5S_HUMAN
Gene Names DMAC2L ATP5S ATPW
Alternative Gene Names ATP5S ATPW
Alternative Protein Names ATP synthase subunit s, mitochondrial (ATP synthase-coupling factor B) (FB) (Distal membrane arm assembly complex 2-like protein) (Mitochondrial ATP synthase regulatory component factor B)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 215
Molecular Weight(Da) 24866
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK
Background
Function FUNCTION: Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway. {ECO:0000250|UniProtKB:P22027}.
Pathway
Protein Families ATP synthase subunit s family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8420337

Recombinant Human DMAC2L protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DMAC2L protein
Copyright © 2021-present Echo Biosystems. All rights reserved.