Recombinant Human DLX4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens distal-less homeobox 4 (DLX4), transcript variant 1 (NM_138281).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q92988
Entry Name DLX4_HUMAN
Gene Names DLX4 BP1 DLX7 DLX8 DLX9
Alternative Gene Names BP1 DLX7 DLX8 DLX9
Alternative Protein Names Homeobox protein DLX-4 (Beta protein 1) (Homeobox protein DLX-7) (Homeobox protein DLX-8)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 240
Molecular Weight(Da) 26263
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
Background
Function FUNCTION: May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis. {ECO:0000269|PubMed:11909945, ECO:0000269|PubMed:25954033}.
Pathway
Protein Families Distal-less homeobox family
Tissue Specificity Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver. {ECO:0000269|PubMed:11069021, ECO:0000269|PubMed:11909945}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8435036

Recombinant Human DLX4 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DLX4 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.