Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9UBU2 |
| Gene Names | DKK2 |
| Alternative Names | Dickkopf 2; Dickkopf gene 2 ; Dickkopf homolog 2 ; Dickkopf related protein 2; Dickkopf WNT signaling pathway inhibitor 2; Dickkopf-2; Dickkopf-related protein 2; Dickkopf2; DKK 2; Dkk-2; Dkk2; DKK2_HUMAN; hDkk 2; hDkk-2; hDkk2 |
| Expression Region | Full Length of Mature Protein(34-259aa ) |
| Molecular Weight | 41 kDa |
| Protein Sequence | KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmbrane protein KREN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease . |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Dickkopf family |
| Tissue Specificity | DKK2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |