Recombinant Human DHFR2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens dihydrofolate reductase 2 (DHFR2), transcript variant 2 (NM_176815).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q86XF0
Entry Name DYR2_HUMAN
Gene Names DHFR2 DHFRL1 DHFRP4
Alternative Gene Names DHFRL1 DHFRP4
Alternative Protein Names Dihydrofolate reductase 2, mitochondrial (Dihydrofolate reductase, mitochondrial) (EC 1.5.1.3) (Dihydrofolate reductase-like protein 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 187
Molecular Weight(Da) 21620
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
Background
Function FUNCTION: Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Binds its own mRNA and that of DHFR. {ECO:0000269|PubMed:21876184, ECO:0000269|PubMed:21876188}.
Pathway Cofactor biosynthesis; tetrahydrofolate biosynthesis; 5,6,7,8-tetrahydrofolate from 7,8-dihydrofolate: step 1/1.
Protein Families Dihydrofolate reductase family
Tissue Specificity Expressed in numerous cell lines. {ECO:0000269|PubMed:21876184}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8604086

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DHFR2 protein
Copyright © 2026-present Echo Bio. All rights reserved.