Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P15924 |
| Gene Names | DSP |
| Alternative Names | 250/210KDA paraneoplastic pemphigus antigen |
| Expression Region | Partial(78-300aa ) |
| Molecular Weight | 28.1 kDa |
| Protein Sequence | CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Major high molecular weight protein of desmosomes. Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and in the anchoring of intermediate filaments to the desmosomes. |
| Involvement in Disease | Keratoderma, palmoplantar, striate 2 (SPPK2); Cardiomyopathy, dilated, with woolly hair and keratoderma (DCWHK); Arrhythmogenic right ventricular dysplasia, familial, 8 (ARVD8); Skin fragility-woolly hair syndrome (SFWHS); Epidermolysis bullosa, lethal acantholytic (EBLA); Cardiomyopathy, dilated, with woolly hair, keratoderma, and tooth agenesis (DCWHKTA) |
| Subcellular Location | Cell junction, desmosome, Cytoplasm, cytoskeleton, Cell membrane |
| Protein Families | Plakin or cytolinker family |
| Tissue Specificity | DSP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |