Recombinant Human DEPP1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens DEPP1 autophagy regulator (DEPP1) (NM_007021).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NTK1
Entry Name DEPP1_HUMAN
Gene Names DEPP1 C10orf10 DEPP FIG
Alternative Gene Names C10orf10 DEPP FIG
Alternative Protein Names Protein DEPP1 (Decidual protein induced by progesterone) (Fasting-induced gene protein) (FIG)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 212
Molecular Weight(Da) 23406
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
Background
Function FUNCTION: Acts as a critical modulator of FOXO3-induced autophagy via increased cellular ROS. {ECO:0000269|PubMed:24530860, ECO:0000269|PubMed:25261981, ECO:0000269|PubMed:28545464}.
Pathway
Protein Families
Tissue Specificity Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. {ECO:0000269|PubMed:16123073}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8095625

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DEPP1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.