Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q13609 |
| Gene Names | DNASE1L3 |
| Alternative Names | DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name: DNase I-like 3 Liver and spleen DNase Short name: LS-DNase Short name: LSD |
| Expression Region | Full Length of Mature Protein(21-305aa ) |
| Molecular Weight | 60.4 kDa |
| Protein Sequence | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units. |
| Involvement in Disease | Systemic lupus erythematosus 16 (SLEB16) |
| Subcellular Location | Nucleus, Endoplasmic reticulum, Secreted |
| Protein Families | DNase I family |
| Tissue Specificity | DNASE1L3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |