Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q92904 |
| Gene Names | DAZL |
| Alternative Names | (DAZ homolog)(DAZ-like autosomal)(Deleted in azoospermia-like 1)(SPGY-like-autosomal) |
| Expression Region | 130-250aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.539 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-653℃. |
| Protein Length | Partial |
| Molecular Weight | 50.2 kDa |
| Protein Sequence | VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
Background
| Research Areas | Developmental Biology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |