Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin beta 131 (DEFB131A) (NM_001040448). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P59861 |
| Entry Name | D131A_HUMAN |
| Gene Names | DEFB131A DEFB131 DEFB31 |
| Alternative Gene Names | DEFB131 DEFB31 |
| Alternative Protein Names | Beta-defensin 131A (Beta-defensin 31) (DEFB-31) (Defensin, beta 131) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 70 |
| Molecular Weight(Da) | 8199 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW |
Background
| Function | FUNCTION: Has antibacterial activity (Probable). Upon stimulation with lipoteichoic acid, promotes cytokines and chemokines production and secretion (PubMed:26649771). {ECO:0000269|PubMed:26649771, ECO:0000305}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | Highly expressed in testis. Is moderately expressed in the prostate and small intestine. {ECO:0000269|PubMed:12600824}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |