Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens defensin beta 118 (DEFB118) (NM_054112). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96PH6 |
| Entry Name | DB118_HUMAN |
| Gene Names | DEFB118 C20orf63 DEFB18 ESC42 |
| Alternative Gene Names | C20orf63 DEFB18 ESC42 |
| Alternative Protein Names | Beta-defensin 118 (Beta-defensin 18) (DEFB-18) (Defensin, beta 118) (Epididymal secretory protein 13.6) (ESP13.6) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 123 |
| Molecular Weight(Da) | 13614 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS |
Background
| Function | FUNCTION: Has antibacterial activity. {ECO:0000305}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | High-level and epididymis-specific expression. Most abundant in the epithelium of the caput and is also present in the lumen and bound to sperm. Expressed also in pancreas. {ECO:0000269|PubMed:12600824}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |