Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin beta 108B (DEFB108B) (NM_001002035). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8NET1 |
| Entry Name | D108B_HUMAN |
| Gene Names | DEFB108B DEFB108 DEFB8 |
| Alternative Gene Names | DEFB108 DEFB8 |
| Alternative Protein Names | Beta-defensin 108B (Beta-defensin 8) (BD-8) (DEFB-8) (hBD-8) (Defensin, beta 108) (Defensin, beta 108B) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 73 |
| Molecular Weight(Da) | 8326 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD |
Background
| Function | FUNCTION: Has antibacterial activity. {ECO:0000250}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | Specifically expressed in testis. Low expression is detected also in liver. {ECO:0000269|PubMed:12600824}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |