Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin beta 104B (DEFB104B) (NM_001040702). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8WTQ1 |
| Entry Name | D104A_HUMAN |
| Gene Names | DEFB104A DEFB104 DEFB4; DEFB104B |
| Alternative Gene Names | DEFB104 DEFB4; |
| Alternative Protein Names | Beta-defensin 104 (Beta-defensin 4) (BD-4) (DEFB-4) (hBD-4) (Defensin, beta 104) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 72 |
| Molecular Weight(Da) | 8526 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP |
Background
| Function | FUNCTION: Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103. {ECO:0000269|PubMed:11481241}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested. {ECO:0000269|PubMed:11481241}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
