Recombinant Human DEFB104A protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens defensin beta 104A (DEFB104A) (NM_080389).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8WTQ1
Entry Name D104A_HUMAN
Gene Names DEFB104A DEFB104 DEFB4; DEFB104B
Alternative Gene Names DEFB104 DEFB4;
Alternative Protein Names Beta-defensin 104 (Beta-defensin 4) (BD-4) (DEFB-4) (hBD-4) (Defensin, beta 104)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 72
Molecular Weight(Da) 8526
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MQRLVLLLAISLLLYQDLPVRSEFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Background
Function FUNCTION: Has antimicrobial activity. Synergistic effects with lysozyme and DEFB103. {ECO:0000269|PubMed:11481241}.
Pathway
Protein Families Beta-defensin family
Tissue Specificity High expression in the testis. Gastric antrum exhibited relatively high levels. A lower expression is observed in uterus and neutrophils thyroid gland, lung, and kidney. No detectable expression in other tissues tested. {ECO:0000269|PubMed:11481241}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8040025

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DEFB104A protein
Copyright © 2021-present Echo Biosystems. All rights reserved.