Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin beta 1 (DEFB1) (NM_005218). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P60022 |
| Entry Name | DEFB1_HUMAN |
| Gene Names | DEFB1 BD1 HBD1 |
| Alternative Gene Names | BD1 HBD1 |
| Alternative Protein Names | Beta-defensin 1 (BD-1) (hBD-1) (Defensin, beta 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 68 |
| Molecular Weight(Da) | 7420 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Background
| Function | FUNCTION: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:25122636). {ECO:0000269|PubMed:25122636}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level). {ECO:0000269|PubMed:25122636, ECO:0000269|PubMed:7628632}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |