Recombinant Human DCTN3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens dynactin subunit 3 (DCTN3), transcript variant 1 (NM_007234).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O75935
Entry Name DCTN3_HUMAN
Gene Names DCTN3 DCTN22
Alternative Gene Names DCTN22
Alternative Protein Names Dynactin subunit 3 (Dynactin complex subunit 22 kDa subunit) (p22)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 186
Molecular Weight(Da) 21119
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE
Background
Function FUNCTION: Together with dynein may be involved in spindle assembly and cytokinesis. {ECO:0000269|PubMed:9722614}.
Pathway
Protein Families Dynactin subunit 3 family
Tissue Specificity Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain. {ECO:0000269|PubMed:9722614}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8116606

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DCTN3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.