Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens dermcidin (DCD), transcript variant 1 (NM_053283). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P81605 |
| Entry Name | DCD_HUMAN |
| Gene Names | DCD AIDD DSEP |
| Alternative Gene Names | AIDD DSEP |
| Alternative Protein Names | Dermcidin (EC 3.4.-.-) (Preproteolysin) [Cleaved into: Survival-promoting peptide; DCD-1] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 110 |
| Molecular Weight(Da) | 11284 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
Background
| Function | FUNCTION: DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues (PubMed:17448443). {ECO:0000269|PubMed:17448443}.; FUNCTION: Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Specifically and constitutively expressed in eccrine sweat gland cells. Secreted into the sweat at a concentration of 1-10 micrograms/ml. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |