Recombinant Human DAOA protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens D-amino acid oxidase activator (DAOA), transcript variant 1 (NM_172370).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P59103
Entry Name DAOA_HUMAN
Gene Names DAOA G72
Alternative Gene Names G72
Alternative Protein Names D-amino acid oxidase activator (Protein G72)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 153
Molecular Weight(Da) 18108
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE
Background
Function FUNCTION: Seems to activate D-amino acid oxidase.
Pathway
Protein Families
Tissue Specificity Expressed in amygdala, caudate nucleus, spinal cord and testis.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8463636

Recombinant Human DAOA protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DAOA protein
Copyright © 2021-present Echo Biosystems. All rights reserved.