Recombinant Human cytomegalovirus Viral interleukin-10 homolog(UL111A)

Specification
Organism Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
Expression Host E.coli
Tag Info N-terminal 10xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID F5HC71
Gene Names UL111A
Alternative Names cmvIL-10 (vIL-10)
Expression Region Full Length of Mature Protein(26-176aa )
Molecular Weight 36
Protein Sequence ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity UL111A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PEHWW517370

Recombinant Human cytomegalovirus Viral interleukin-10 homolog(UL111A)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human cytomegalovirus Viral interleukin-10 homolog(UL111A)
Copyright © 2021-present Echo Biosystems. All rights reserved.