Specification
Organism | Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | F5HCH8 |
Gene Names | gL |
Alternative Names | / |
Expression Region | Full Length of Mature Protein(31-278aa ) |
Molecular Weight | 57.5 kDa |
Protein Sequence | AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL (By similarity). |
Involvement in Disease | |
Subcellular Location | Virion membrane, Peripheral membrane protein, Extracellular side, Host cell membrane, Peripheral membrane protein, Extracellular side, Host Golgi apparatus, host trans-Golgi network |
Protein Families | Herpesviridae glycoprotein L family |
Tissue Specificity | gL |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |