Specification
| Organism | Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P13200 |
| Gene Names | UL99 |
| Alternative Names | 28KDA structural phosphoprotein pp28 |
| Expression Region | Full Length of Mature Protein(2-190aa ) |
| Molecular Weight | 24.8 kDa |
| Protein Sequence | GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | UL99 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |