Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial

Specification
Organism Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P06725
Gene Names UL83
Alternative Names 65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83
Expression Region Partial(351-480aa )
Molecular Weight 18.2 kDa
Protein Sequence FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.
Involvement in Disease
Subcellular Location Virion tegument, Host nucleus, Host cytoplasm
Protein Families Herpesviridae pp65 family
Tissue Specificity UL83
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEHWV362055

Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.