Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P31785 |
| Gene Names | IL2RG |
| Alternative Names | (Interleukin-2 receptor subunit gamma)(IL-2 receptor subunit gamma)(IL-2R subunit gamma)(IL-2RG)(gammaC)(p64)(CD antigen CD132) |
| Expression Region | 56-254aa(N75Q) |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.40 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-132℃. |
| Protein Length | Partial |
| Molecular Weight | 26.6 kDa |
| Protein Sequence | PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
Background
| Research Areas | Cancer |
| Relevance | Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 . |
| Function | |
| Reference | "Interleukin-15 enhances human neutrophil phagocytosis by a Syk-dependent mechanism: importance of the IL-15Ralpha chain." Ratthe C., Girard D. J. Leukoc. Biol. 76:162-168(2004) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
