Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P53701 |
| Gene Names | HCCS |
| Alternative Names | Holocytochrome c-type synthase |
| Expression Region | Full Length(1-268aa ) |
| Molecular Weight | 57.6 kDa |
| Protein Sequence | MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Links covalently the heme group to the apoprotein of cytochrome c. |
| Involvement in Disease | Linear skin defects with multiple congenital anomalies 1 (LSDMCA1) |
| Subcellular Location | Mitochondrion inner membrane, Membrane, Lipid-anchor |
| Protein Families | Cytochrome c-type heme lyase family |
| Tissue Specificity | HCCS |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |