Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P20674
Gene Names COX5A
Alternative Names Cytochrome c oxidase polypeptide Va
Expression Region Full Length of Mature Protein(42-150aa )
Molecular Weight 39.5 kDa
Protein Sequence SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Involvement in Disease Mitochondrial complex IV deficiency is a rare condition caused by mutation in COX5A that lead to pulmonary arterial hypertension (PAH), failure to thrive and lactic acidemia.
Subcellular Location Mitochondrion inner membrane
Protein Families Cytochrome c oxidase subunit 5A family
Tissue Specificity COX5A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR44h4269

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)
Copyright © 2021-present Echo Biosystems. All rights reserved.