Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P13073 |
| Gene Names | COX4I1 |
| Alternative Names | Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1 ;COX IV-1 |
| Expression Region | Full Length of Mature Protein(23-169aa ) |
| Molecular Weight | 33.2 kDa |
| Protein Sequence | AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion inner membrane |
| Protein Families | Cytochrome c oxidase IV family |
| Tissue Specificity | COX4I1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |