Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9GZY4 |
| Gene Names | COA1 |
| Alternative Names | Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15KDA |
| Expression Region | Partial(38-146aa ) |
| Molecular Weight | 39.4 kDa |
| Protein Sequence | QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of some MITRAC complex, a cytochrome c oxidase (COX) assbly intermediate complex that regulates COX assbly. MITRAC complexes regulate both translation of mitochondrial encoded components and assbly of nuclear-encoded components imported in mitochondrion. Required for assbly of mitochondrial respiratory chain complex I and complex IV. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion inner membrane, Single-pass membrane protein |
| Protein Families | COA1 family |
| Tissue Specificity | COA1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
