Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O14949 |
| Gene Names | UQCRQ |
| Alternative Names | Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C |
| Expression Region | Partial(2-78aa ) |
| Molecular Weight | 36.3 kDa |
| Protein Sequence | GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone. |
| Involvement in Disease | Mitochondrial complex III deficiency, nuclear 4 (MC3DN4) |
| Subcellular Location | Mitochondrion inner membrane |
| Protein Families | UQCRQ/QCR8 family |
| Tissue Specificity | UQCRQ |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |