Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P04839 |
| Gene Names | CYBB |
| Alternative Names | CGD91-phoxCytochrome b(558) subunit beta ;Cytochrome b558 subunit betaHeme-binding membrane glycoprotein gp91phoxNADPH oxidase 2Neutrophil cytochrome b 91KDA polypeptide;Superoxide-generating NADPH oxidase heavy chain subunitgp91-1gp91-phoxp22 phagocyte B-cytochrome |
| Expression Region | Cytoplasmic Domain(283-570aa ) |
| Molecular Weight | 49.2 kDa |
| Protein Sequence | ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Critical component of the mbrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from Cytoplasmic domain NADPH across the plasma mbrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. |
| Involvement in Disease | Granulomatous disease, chronic, X-linked (CGD); Immunodeficiency 34 (IMD34) |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | |
| Tissue Specificity | CYBB |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
