Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P04080 |
Gene Names | CSTB |
Alternative Names | CPI-BLiver thiol proteinase inhibitorStefin-B |
Expression Region | Full Length(1-98aa ) |
Molecular Weight | 38.1 kDa |
Protein Sequence | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. |
Involvement in Disease | Epilepsy, progressive myoclonic 1 (EPM1) |
Subcellular Location | Cytoplasm, Nucleus |
Protein Families | Cystatin family |
Tissue Specificity | CSTB |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |