Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Baculovirus |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P11802 |
| Gene Names | CDK4 |
| Alternative Names | Cyclin-dependent kinase 4 Cyclin-dependent kinase 4, isoform CRA_c |
| Expression Region | Full Length of Mature Protein(2-303aa ) |
| Molecular Weight | 35.6 kDa |
| Protein Sequence | ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Melanoma, cutaneous malignant 3 (CMM3) |
| Subcellular Location | Cytoplasm, Nucleus, Membrane |
| Protein Families | Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily |
| Tissue Specificity | CDK4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |