Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q16667 |
Gene Names | CDKN3 |
Alternative Names | CDK2-associated dual-specificity phosphatase Cyclin-dependent kinase interactor 1 Cyclin-dependent kinase-interacting protein 2 Kinase-associated phosphatase |
Expression Region | Full Length(1-212aa ) |
Molecular Weight | 25.8 kDa |
Protein Sequence | MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner. |
Involvement in Disease | Hepatocellular carcinoma (HCC) |
Subcellular Location | Cytoplasm, perinuclear region |
Protein Families | Protein-tyrosine phosphatase family |
Tissue Specificity | CDKN3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |