Recombinant Human Cyclin-dependent kinase 4 inhibitor B(CDKN2B)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P42772
Gene Names CDKN2B
Alternative Names Multiple tumor suppressor 2 (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B) (MTS2)
Expression Region Full Length(1-138aa )
Molecular Weight 19.7 kDa
Protein Sequence MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity CDKN2B
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE2HU5217

Recombinant Human Cyclin-dependent kinase 4 inhibitor B(CDKN2B)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Cyclin-dependent kinase 4 inhibitor B(CDKN2B)
Copyright © 2021-present Echo Biosystems. All rights reserved.