Recombinant Human CT45A3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens cancer/testis antigen family 45 member A3 (CT45A3), transcript variant 2 (NM_001017435).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8NHU0
Entry Name CT453_HUMAN
Gene Names CT45A3 CT45-3 CT45-4 CT45A4
Alternative Gene Names CT45-3 CT45-4 CT45A4
Alternative Protein Names Cancer/testis antigen family 45 member A3 (Cancer/testis antigen 45-3) (Cancer/testis antigen 45-4) (Cancer/testis antigen 45A3) (Cancer/testis antigen 45A4) (Cancer/testis antigen family 45 member A4)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 189
Molecular Weight(Da) 21331
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
Background
Function
Pathway
Protein Families CT45 family
Tissue Specificity Testis specific. Expressed in cancer cell lines. {ECO:0000269|PubMed:15905330}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8139205

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CT45A3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.