Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cystatin A (CSTA) (NM_005213). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P01040 |
| Entry Name | CYTA_HUMAN |
| Gene Names | CSTA STF1 STFA |
| Alternative Gene Names | STF1 STFA |
| Alternative Protein Names | Cystatin-A (Cystatin-AS) (Stefin-A) [Cleaved into: Cystatin-A, N-terminally processed] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 98 |
| Molecular Weight(Da) | 11006 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
Background
| Function | FUNCTION: This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis. {ECO:0000269|PubMed:21944047}. |
| Pathway | |
| Protein Families | Cystatin family |
| Tissue Specificity | Expressed in the skin throughout the epidermis. {ECO:0000269|PubMed:21944047}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |