Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cysteine rich protein 1 (CRIP1) (NM_001311). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P50238 |
| Entry Name | CRIP1_HUMAN |
| Gene Names | CRIP1 CRIP CRP1 |
| Alternative Gene Names | CRIP CRP1 |
| Alternative Protein Names | Cysteine-rich protein 1 (CRP-1) (Cysteine-rich heart protein) (CRHP) (hCRHP) (Cysteine-rich intestinal protein) (CRIP) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 77 |
| Molecular Weight(Da) | 8533 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK |
Background
| Function | FUNCTION: Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. |
| Pathway | |
| Protein Families | |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |