Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens complexin 2 (CPLX2), transcript variant 1 (NM_006650). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q6PUV4 |
| Entry Name | CPLX2_HUMAN |
| Gene Names | CPLX2 |
| Alternative Gene Names | |
| Alternative Protein Names | Complexin-2 (Complexin II) (CPX II) (Synaphin-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 134 |
| Molecular Weight(Da) | 15394 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK |
Background
| Function | FUNCTION: Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles. Also involved in mast cell exocytosis (By similarity). {ECO:0000250|UniProtKB:P84086, ECO:0000250|UniProtKB:P84088}. |
| Pathway | |
| Protein Families | Complexin/synaphin family |
| Tissue Specificity | Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia. {ECO:0000269|PubMed:11483314, ECO:0000269|PubMed:11576753, ECO:0000269|PubMed:15906159, ECO:0000269|PubMed:16162394, ECO:0000269|PubMed:9853440}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |